Achromobacter sp. AONIH1: C2U31_02695 Help Entry C2U31_02695       CDS       T05288                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism achr  Achromobacter sp. AONIH1 Brite KEGG Orthology (KO) [BR:achr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:achr03110]     C2U31_02695 (grxC) Chaperones and folding catalysts [BR:achr03110]  Protein folding catalysts   Protein disulfide isomerase    C2U31_02695 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 GST_N_2 Thioredoxin_2 Thioredoxin_4 HrpB4 Motif Other DBs NCBI-ProteinID:  AUT44963 UniProt:  A0A2I8DCA0 LinkDB All DBs Position 580798..581055 Genome browser AA seq 85 aa AA seqDB search MNKVVMYSKDYCPYCARAKALLEQRGVADLEIIQIDRDPAQRDIMIERTGRRTVPQIFIG DTHVGGCDDLMALDRAGGLAPLLNG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagttgtcatgtacagcaaggattattgcccctactgcgcccgcgccaaggcg ctgctggagcagcgcggcgtggccgacctggaaatcatccagatcgaccgcgatccggcc cagcgcgacatcatgatcgagcgcaccggccgccgcaccgtgccccagatcttcatcggc gacacccacgtgggcggctgtgacgacctgatggcgctggatcgcgcgggcggcctcgcg cccctgctcaacggctga

DBGET integrated database retrieval system