Achromobacter sp. AONIH1: C2U31_18605
Help
Entry
C2U31_18605 CDS
T05288
Name
(GenBank) MFS transporter
KO
K19577
MFS transporter, DHA1 family, inner membrane transport protein
Organism
achr
Achromobacter sp. AONIH1
Brite
KEGG Orthology (KO) [BR:
achr00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
achr02000
]
C2U31_18605
Transporters [BR:
achr02000
]
Major facilitator superfamily (MFS)
Drug transporters
Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:
2.A.1.2
]
C2U31_18605
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
Sugar_tr
MFS_4
Motif
Other DBs
NCBI-ProteinID:
AUT47830
LinkDB
All DBs
Position
complement(4046012..4047214)
Genome browser
AA seq
400 aa
AA seq
DB search
MPLHLIALAAAAFGIGTSEFVIMGLLPDVAADLGVSIDITGLLITGYAMGVVIGAPIMAI
ITARLPRKTTLIGLASTFVIGNLLCALAPGYATLMAARVFTAFCHGAFFGIGAVVAADLV
PRNQRSSAIALMFTGLTLANVLGVPLGTALGQAAGWRSTFWVVSGIGLLAVAALAAWLPA
RIPMQPGNILREFKVLRDPRVLWPLAASVLASAALFCVLTYIAPLLRDVTGVSERGVTGV
LLLFGVALTVGSTLGGRLGDRNLEFWLTRMFAGLVLVFLALSQAVHALAPMLALVFVWGT
LGFALVPLLQTLIVDQAAEAPNLASTLNQGAFNLGNAGGAWLGSMALGSGLPLTGLPWMS
AAIAMAALLLTLWGTRRHGRRAATLAGQAGGEALPLRSNA
NT seq
1203 nt
NT seq
+upstream
nt +downstream
nt
atgcccttgcacctcatcgcgctggccgccgccgctttcggcatcggcaccagcgaattc
gtcatcatgggcctgctgcccgacgtggccgccgacctgggcgtgtcgatcgacattacc
ggcctcttgatcaccggctacgccatgggcgtggtgatcggcgcgcccatcatggccatc
atcaccgcccggctgccgcgcaagaccacgctgatcgggctggccagcaccttcgtgatc
ggcaacctgctgtgcgcgctggcgcccggctacgccacgttgatggcggcgcgcgtgttc
acggccttctgccacggcgccttcttcggcatcggcgcggtggtggccgccgaccttgtg
ccgcgcaaccagcgctccagcgccatcgcgctgatgttcaccggcctgacgctggccaat
gtgctgggcgtgccgctgggcacggcactgggccaggccgccggctggcgctcgaccttc
tgggtggtcagcggcatcggcctgctcgcggtggcggcgctggcggcctggctgccggcc
cgcatcccgatgcagcccggcaacatcctgcgcgaattcaaggtgctgcgcgatccgcgc
gtgctatggccgctggccgccagcgtgctggcctcggccgccctgttctgcgtgctgacc
tatatcgcgccgctactgcgcgacgtgaccggcgtgtccgagcgcggcgtcaccggcgtg
ctgctgctgttcggcgtggcgctgaccgtgggcagcactctgggcggccggctgggcgac
cgcaacctggaattctggctgacgcgcatgttcgcggggctggtgctggtgttcctggcg
ctgtcgcaggcggtgcacgcgctggcgcccatgctggcgctggtgttcgtctggggcacg
ctgggcttcgcgctggtgccgctgctgcagacgctgatcgtggaccaggcggccgaagcg
cccaacctggcgtccacgctgaaccagggcgcgttcaacctgggcaacgccggcggcgcc
tggctgggcagcatggcgctgggcagcggcctgccgctgaccggcctgccctggatgtcc
gccgccatcgccatggcggcgctgctgctgacgctgtggggcacccgccgccacggccgc
cgcgcggctacactggccggacaagccggcggcgaagccctgccgctgcgctcgaacgcc
tga
DBGET
integrated database retrieval system