KEGG   Anaerocolumna chitinilytica: bsdcttw_31350
Entry
bsdcttw_31350     CDS       T07655                                 
Symbol
yrbD
Name
(GenBank) hydrolase acting on acid anhydrides in phosphorous-containing anhydrides
Organism
acht  Anaerocolumna chitinilytica
SSDB
Motif
Pfam: Voltage_CLC TrkA_C
Other DBs
NCBI-ProteinID: BCK00095
UniProt: A0A7I8DS20
LinkDB
Position
3612564..3614135
AA seq 523 aa
MKKTNNYSQAVREYSRQMSIIIKSMIAGLLAGLISSAYRFLLLKAEFASFSAYHFIRNHL
QLIPFLFILLAGLGLLTMLLVKRYPLISGSGIPQVKGIISGYITQNWLSTLIGKFAGGIL
AILAGLSLGREGPSIQLGASVAEGLADKFSETKFEKKILIASGAGAGLAAAFNAPLAGAL
FALEEIYKYFSPIVCLSALASAVVADYVSKLIFGTAPVFLFGQFADIPLKSYWILLLLGI
LLGIFGFFYNKSILLSQKLYKKGQKLIGRYILLLPFLLAGILGLTFPFVCGGGHVLINKI
NFKSGLLFLLFALVLKFLFSVISFGSGAPGGIFFPFLVMGALAGGITAKISIQYLGLPEN
VFYTLVTLSMCGFFSAIVRAPITGIILLAEMTGSVTTLLPLTVVSVISYMTADMLKSAPI
YDSLLHSLIHNIGSEYMRMDVNSKVTFESIIHHGSPAADKKIKELGMPDNCLLIAVKREN
QEFIPNGSTILKEGDLLVLLTDVKEEATIRNSISDLTESSVLT
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgaaaaaaacaaacaactatagtcaggcagtaagggaatattcaaggcaaatgagtatt
attattaaaagtatgattgcagggcttcttgcaggattaatatccagtgcttatcgtttt
ctactgctgaaagcagaattcgcttccttttctgcatatcatttcattcggaaccacctc
caattaattcccttcctctttatactgctggcaggtttgggactgctgaccatgcttcta
gttaaaagatatcctttaatcagcggaagtggtatcccacaggtaaaagggataatatca
ggatacataactcagaattggctctctactctgataggaaaatttgcaggaggtatcctg
gcaattctggccggcttatcccttggcagggaaggcccatccattcagttaggcgcttct
gtagctgaaggccttgctgataagttttcagaaaccaaatttgaaaagaagattctcatt
gccagtggtgcaggtgcaggactggccgctgcttttaatgctccgttagccggtgccctg
tttgccctggaagaaatatataagtatttctctccaatcgtatgtctttcagctctggct
tccgcggtggtcgctgattatgtttctaaattgatatttggaactgctcctgtttttcta
ttcggtcaatttgctgatataccgcttaagagctattggatcttgcttcttttaggaatt
cttcttggtatttttggatttttttataataaatcaattttgttatcccagaaattatat
aaaaaagggcagaaattaataggtcgctacattcttttgcttccctttcttctggcaggt
attctaggtctcacctttccctttgtatgcggtggaggacatgttctaatcaataaaatt
aattttaaatccggtcttctgttcctgctttttgctttggtgctaaaatttcttttttcc
gtcatatcctttggttctggagccccaggtggcatattctttccctttttggtcatgggt
gccctggctggtggtattaccgctaagatttctatccaatacttaggtcttccggaaaat
gttttctacactttggttactctgtccatgtgtggatttttcagtgctatcgtacgagca
ccaataactggtattattctattagctgaaatgactggttccgtaactactctgctcccc
cttacagtagtttccgttatttcatatatgactgcagatatgttaaagagcgctccgatt
tatgactcgctgctgcattctttgattcataacataggttcggaatatatgcggatggac
gtcaatagtaaggttacatttgaatcaatcatacatcatggctcacctgcagccgataaa
aaaatcaaagaactgggaatgcctgataactgccttttaatagcagtaaaaagagagaac
caggaatttatcccaaatggcagcacgattctaaaagaaggtgaccttttggtactttta
acggatgttaaagaggaagctactattcgaaacagcatttctgatcttacggagtcttct
gttcttacttaa

DBGET integrated database retrieval system