Acidilobus sp. 7A: SE86_00330 Help Entry SE86_00330        CDS       T05595                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism acia  Acidilobus sp. 7A Pathway acia03010   Ribosome Brite KEGG Orthology (KO) [BR:acia00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SE86_00330   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SE86_00330  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:acia03011]     SE86_00330    04121 Ubiquitin system [BR:acia04121]     SE86_00330   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acia04147]     SE86_00330 Ribosome [BR:acia03011]  Ribosomal proteins   Eukaryotes    Small subunit     SE86_00330   Archaea     SE86_00330 Ubiquitin system [BR:acia04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SE86_00330 Exosome [BR:acia04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SE86_00330   Exosomal proteins of colorectal cancer cells    SE86_00330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_SprT Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_3 Zn_ribbon_RPB9 Zn_ribbon_PriA DUF7573 NRDD Zn_ribbon_Nudix YhfH Zn_Ribbon_1 MRNIP DUF7479 DUF7838 EDR4-like_1st DZR Motif Other DBs NCBI-ProteinID:  AMD31162 LinkDB All DBs Position 65075..65257 Genome browser AA seq 60 aa AA seqDB search MAKQVKAPVHLLYEVDYSTMTIKPKNKKCPKCGNYMAHHLKPVERWHCGYCGYTEFVVKE NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggcaaagcaggttaaggcccctgtccacctgctctacgaggtggactacagcaccatg actataaagcctaagaacaagaagtgccccaagtgcggcaactacatggcccaccacctt aagcccgtggagaggtggcactgtgggtactgcggctacacggagttcgtggtcaaggag tga

DBGET integrated database retrieval system