KEGG   Acidovorax carolinensis NA2: CBP33_00285
Entry
CBP33_00285       CDS       T04914                                 
Name
(GenBank) phosphonate ABC transporter
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:acid00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CBP33_00285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acid02000]
    CBP33_00285
Enzymes [BR:acid01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     CBP33_00285
Transporters [BR:acid02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    CBP33_00285
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_25 AAA_22 AAA_30 AAA_33 AAA_29 AAA_28 NACHT RsgA_GTPase AAA_16 nSTAND1 DO-GTPase2 Mg_chelatase DEAD AAA_18 nSTAND3 AAA_24 TsaE IstB_IS21 AAA_23 MMR_HSR1
Other DBs
NCBI-ProteinID: ART46772
LinkDB
Position
complement(63083..63913)
AA seq 276 aa
MKVQLDSATVRHPAARAGAPAALRGLSLAVAQGEQVAVIGPSGAGKTTLLQLLACAQRPA
IGRLQLDGRDPWVLPRGALQRLRGHLFLAPQVPPLPPRQRVVTAALAGRLPHESLWASVR
SLVYPTGIGLAEAALAHFDVADKLFDRVDRLSGGERQRVGLARALASQASLLLVDEPLSA
LDPARAQQALASLTQAARERGATLIATLHHVDMALAHFPRVIGLRDGALAFDLPAAQVTP
AHLHQLYAQHLDELTQTAPPAPDAPVAAAPVPMQCR
NT seq 831 nt   +upstreamnt  +downstreamnt
atgaaagtgcagctggacagcgccaccgtgcgccacccggccgcgcgcgctggtgcaccg
gcagcattgcgcggcctgagcctcgcggtagcgcagggcgagcaggtggccgtgatcggg
ccgtcgggcgcgggcaagaccacgctgctgcagctgctggcctgcgcgcagcggcccgcc
attggccgcctgcaactggatggccgcgacccatgggtgctgccccgcggcgcattgcag
cgcttgcgcggccatctgtttctcgccccccaggtgccgccgctgccgccccggcagcgc
gtcgtcacggcggcgctggcagggcgcctgccgcacgaaagcctgtgggccagcgtgcgc
agcctggtctatcccaccggcatcgggctggccgaggctgcgctggcgcattttgacgtg
gccgacaagctgttcgaccgggtagaccgcctctcgggcggcgagcgccagcgggtgggc
ctggcgcgggcgctggcctcgcaggccagcctgctgctggtggacgagcccctgtccgcg
ctcgacccggcgcgcgcgcagcaggccctggcctcgctcacgcaggcagcccgcgagcgt
ggcgccacgctgattgccacgctacaccatgtggacatggccctggcgcatttcccgcgc
gtgatcgggttgcgcgatggcgcactggcctttgacctgcctgcggcgcaggtgacgccc
gcgcacctgcaccagctgtatgcgcagcacctggacgagctgacgcaaacggcgccgccc
gcccccgatgcgcccgtggctgcggcacccgtgcccatgcagtgccgctag

DBGET integrated database retrieval system