Acidovorax carolinensis NA2: CBP33_01435 Help Entry CBP33_01435       CDS       T04914                                  Name (GenBank) phosphocarrier protein HPr   KO K02784   phosphocarrier protein HPr Organism acid  Acidovorax carolinensis NA2 Pathway acid02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:acid00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     CBP33_01435  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:acid02000]     CBP33_01435 Transporters [BR:acid02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     CBP33_01435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  ART46955 UniProt:  A0A247D3Q5 LinkDB All DBs Position 290782..291051 Genome browser AA seq 89 aa AA seqDB search MIKTRTTINNKLGLHARASAKLTKLAGSFPCDVFMSRGDRRINAKSIMGVMMLAAGMGIE IEIETVGEREQEAMDALLALIADKFGEGE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgatcaagacccgcacgaccatcaacaataagctgggcctgcatgcccgggcgtcggcc aagctgaccaagctggccggcagctttccgtgcgatgttttcatgagccggggtgatcgc cgtatcaacgccaagagcatcatgggggtgatgatgctggctgcgggcatgggtatcgaa attgaaatcgagaccgttggcgagcgcgagcaggaggccatggatgcgttgctcgcattg attgccgacaagttcggcgagggcgaatga

DBGET integrated database retrieval system