Acidovorax carolinensis NA2: CBP33_07810
Help
Entry
CBP33_07810 CDS
T04914
Name
(GenBank) aspartate aminotransferase
KO
K05825
2-aminoadipate transaminase [EC:2.6.1.-]
Organism
acid
Acidovorax carolinensis NA2
Pathway
acid00300
Lysine biosynthesis
acid00630
Glyoxylate and dicarboxylate metabolism
acid01100
Metabolic pathways
acid01110
Biosynthesis of secondary metabolites
acid01210
2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:
acid00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
CBP33_07810
09105 Amino acid metabolism
00300 Lysine biosynthesis
CBP33_07810
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Asp_aminotransf
DegT_DnrJ_EryC1
Diphtheria_R
Beta_elim_lyase
NifU
Motif
Other DBs
NCBI-ProteinID:
ART48043
UniProt:
A0A240TSC7
LinkDB
All DBs
Position
1647153..1648343
Genome browser
AA seq
396 aa
AA seq
DB search
MQFADRLNNVETSAIRELFKLLGKPGIISFAGGFPDSAMFDVDGIRAASNAALAEEPGAA
LQYGATEGYQPLREQLAAFMASKGAPDVAPDQLIVTTGSQQALDLLGKTMIGPGDKVIVE
GPTFLATIQCFRLYGAEVISAPIDGDGVQVDALEQLIAEHRPKLVYLIPTFGNPSGATLS
LARRKKVLELAVKYQTLVVEDDPYGDLYFGEAPPPSLLALSSEVPGSREWLAHCGSLSKV
LSPGLRIGWLIAPPELLAKAVMCKQFSDAHTSTFAQATAAQYLKAGRMPATLANVRKVYA
ERALALRDALRQELGDAVEFVQPKGGLFVWLRLTGAGGKVADANVLAKSAIEKGVAFVPG
TPFFAQNPDHATLRLSFATADVDKIREGVARLAQAL
NT seq
1191 nt
NT seq
+upstream
nt +downstream
nt
atgcaatttgccgatcgtctgaacaacgtagaaacctctgccatccgagagctcttcaag
ctgctgggcaagcccggcatcatcagctttgccgggggctttcccgacagcgccatgttc
gacgtggacggtattcgcgctgccagcaatgccgctctggccgaggagccgggtgctgct
ttgcagtacggcgccaccgaaggctaccagccgctgcgcgagcagctggccgccttcatg
gcaagcaaaggggccccggatgtggcgcccgatcagctcatcgtcaccaccggcagccag
caggcgctggacctgctgggcaagaccatgatcggccccggcgacaaggtgatcgtagaa
ggccccacctttctggccaccatccagtgctttcgcctgtatggcgccgaggtcatcagc
gcgcccatcgatggcgatggcgtgcaggtggacgcgctggagcagctcattgccgagcac
cgccctaaactggtgtacctgatccccacctttggcaatcccagcggcgccacgctgagc
ctggcgcgccgcaaaaaggtgctggagctggccgtgaagtaccagaccctggtggtggaa
gacgatccctatggcgacctgtattttggcgaggcaccaccgcccagcctgctggcgctg
tccagcgaggtgcccggcagccgcgaatggctggcgcactgcggcagtttgagcaaggtg
ctcagccccggcctgcgcattggctggctgatcgccccgccagagctgctggccaaggcc
gtgatgtgcaagcagttcagcgacgcgcacaccagcacgtttgcccaggccacggcggcg
caatacctcaaggccggccgcatgcccgcaaccctggcgaatgtgcgcaaggtctatgcc
gagcgcgccctggcgctgcgcgatgcactgcgccaggagctgggcgatgccgtggagttt
gtgcaacccaaaggaggcctgttcgtgtggctgcgcctcaccggtgcgggcggcaaagtg
gctgatgccaacgtgctggccaagtccgccatcgaaaaaggcgtggcctttgtgcccggc
acgccgttctttgcccagaaccccgaccacgccacgctgcgcctgtcgttcgccacggcc
gatgtggacaagatccgcgagggcgtggcacgcctggcgcaggcgctctga
DBGET
integrated database retrieval system