Acidovorax carolinensis NA2: CBP33_13865 Help Entry CBP33_13865       CDS       T04914                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acid  Acidovorax carolinensis NA2 Pathway acid01100   Metabolic pathways acid01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acid00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CBP33_13865    00074 Mycolic acid biosynthesis     CBP33_13865   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CBP33_13865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  ART49080 LinkDB All DBs Position complement(2968124..2968363) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgcgtcaaaaaaatcattgccgaacaactcggcgttgaagag tcccaagtcaccaacgaaaaagcctttgtggccgacctcggcgctgattctctggatacc gtcgaactcgtgatggcactcgaagacgaattcggcatcgagattcctgacgaagacgca gagaagatcacgacggtgcaaaacgccatcgactacgccaacacccaccagaaagcctga

DBGET integrated database retrieval system