Acinetobacter sp. BHS4: KIP84_12140 Help Entry KIP84_12140       CDS       T09875                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism acie  Acinetobacter sp. BHS4 Pathway acie00361   Chlorocyclohexane and chlorobenzene degradation acie00362   Benzoate degradation acie00623   Toluene degradation acie01100   Metabolic pathways acie01120   Microbial metabolism in diverse environments acie01220   Degradation of aromatic compounds Module acie_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:acie00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     KIP84_12140    00361 Chlorocyclohexane and chlorobenzene degradation     KIP84_12140    00623 Toluene degradation     KIP84_12140 Enzymes [BR:acie01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      KIP84_12140     1.14.13.244  phenol 2-monooxygenase (NADH)      KIP84_12140 SSDB OrthologParalogGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  QVR66808 LinkDB All DBs Position 2521491..2521853 Genome browser AA seq 120 aa AA seqDB search MTVRAIHNNYQFEPLDLQKNYGDQFLLYVGWDHHTLFCSAHAMLASPQQTFGQLIEQQIT GGFAQHPDFAKIDWSKVQYTLNGQTIEPESTKTLAELGFGHKSLLRFVTPELNGYNDSYV NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgactgttcgcgcaatacacaacaactatcaatttgaaccgcttgatctacaaaaaaat tatggcgatcaattcttactttacgtgggttgggatcatcacacccttttttgctcggca catgccatgcttgcctcccctcaacaaacttttggacagttgattgagcaacaaattaca ggtggttttgcccaacatccagattttgccaaaattgattggtcaaaagtgcaatacacc ttaaatggtcaaacaatcgaaccagagagtacaaaaactttggcagagcttggttttgga cataagtcattacttcgtttcgttacgccagagttaaatggctataacgacagctacgtt taa

DBGET integrated database retrieval system