Acinetobacter sp. LoGeW2-3: BS636_13905 Help Entry BS636_13905       CDS       T10253                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism acig  Acinetobacter sp. LoGeW2-3 Brite KEGG Orthology (KO) [BR:acig00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acig03032]     BS636_13905    03036 Chromosome and associated proteins [BR:acig03036]     BS636_13905    03400 DNA repair and recombination proteins [BR:acig03400]     BS636_13905 DNA replication proteins [BR:acig03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BS636_13905 Chromosome and associated proteins [BR:acig03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BS636_13905 DNA repair and recombination proteins [BR:acig03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BS636_13905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 ACP_syn_III_C Motif Other DBs NCBI-ProteinID:  ATO20693 UniProt:  A0A2D1ISU0 LinkDB All DBs Position complement(2861251..2861523) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAEKGGLSKADAGKALDATIASVTEALKSGDTVTLVGFGTFGVKERAARTG RNPQTGATLEIKASKVPSFKAGKGLKDAVA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcagaattaattgatgcaattgcagagaaagggggattatctaaggctgac gcaggtaaagctttagatgctacaattgcttctgttactgaagctctaaaatcaggtgac acagttactctagttggttttggtactttcggcgttaaagaacgtgctgcacgtactggc cgtaacccacaaactggtgcaacgcttgaaattaaagcaagcaaagtacctagcttcaaa gctggcaaaggcttaaaagacgctgtagcttaa

DBGET integrated database retrieval system