Acidiferrobacter sp. SPIII_3: C4901_00855 Help Entry C4901_00855       CDS       T05469                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism acii  Acidiferrobacter sp. SPIII_3 Brite KEGG Orthology (KO) [BR:acii00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:acii03110]     C4901_00855 (grxC) Chaperones and folding catalysts [BR:acii03110]  Protein folding catalysts   Protein disulfide isomerase    C4901_00855 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 SH3BGR Glrx-like Thioredoxin_2 TraF Motif Other DBs NCBI-ProteinID:  AWP22074 UniProt:  A0A2Z3QW66 LinkDB All DBs Position complement(164286..164543) Genome browser AA seq 85 aa AA seqDB search MAKVLMYTTRVCPYCQMASRLLEQKGIPVEKVRVDEEPERRREMVERARGATTVPQIFIG DRHIGGYRELAQLDVRGELDPLLGL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccaaggtcttgatgtacactacgcgcgtatgcccctattgccagatggcctcgcgc ctcctggaacaaaagggcattccggtcgagaaggtccgcgtggacgaagagcccgagcgg cgccgagagatggtcgagcgggcgcgtggcgccaccacggtcccgcagatcttcataggc gaccgtcacatcggaggctaccgggagctcgcgcaactggacgtaaggggggaactcgat cccctgcttggcctgtga

DBGET integrated database retrieval system