Acidiferrobacter sp. SPIII_3: C4901_07735 Help Entry C4901_07735       CDS       T05469                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acii  Acidiferrobacter sp. SPIII_3 Pathway acii01100   Metabolic pathways acii01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acii00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C4901_07735    00074 Mycolic acid biosynthesis     C4901_07735   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C4901_07735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PIN Motif Other DBs NCBI-ProteinID:  AWP23234 LinkDB All DBs Position 1549651..1549917 Genome browser AA seq 88 aa AA seqDB search MNSRQTDFEREIAQLLVSSLNLALDADSIDPEAPLFREGLGLDSIDMLEIALAISQHYGI QLRSDDPENGVIFASLRALAATIGARRT NT seq 267 nt NT seq  +upstreamnt  +downstreamnt gtgaatagcaggcaaaccgattttgagcgcgagattgcgcagctgctcgtgagcagcctg aacctggcgctcgatgcggactccatcgatcccgaggccccgctgtttcgcgagggtctg gggctcgattcgatcgacatgctggagattgcgttggcgatctcccagcattatggtatc caactgcgatccgatgacccggagaacggcgtcatcttcgcgtccctgcgggcgctcgcc gcgaccatcggcgcacgccggacttaa

DBGET integrated database retrieval system