Acidipropionibacterium virtanenii: JS278_01103 Help Entry JS278_01103       CDS       T05538                                  Symbol hup Name (GenBank) DNA-binding protein HB1   KO K03530   DNA-binding protein HU-beta Organism acij  Acidipropionibacterium virtanenii Brite KEGG Orthology (KO) [BR:acij00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acij03032]     JS278_01103 (hup)    03036 Chromosome and associated proteins [BR:acij03036]     JS278_01103 (hup)    03400 DNA repair and recombination proteins [BR:acij03400]     JS278_01103 (hup) DNA replication proteins [BR:acij03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JS278_01103 (hup) Chromosome and associated proteins [BR:acij03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JS278_01103 (hup) DNA repair and recombination proteins [BR:acij03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JS278_01103 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF937 Mnd1 ABCA11_C Motif Other DBs NCBI-ProteinID:  AXE38286 UniProt:  A0A344USN8 LinkDB All DBs Position complement(1215299..1215574) Genome browser AA seq 91 aa AA seqDB search MTKSELIKAIAKQASLTEAQTNEAVKALTDVITDALAKGDKIQLPGLLTAETVERPARNG RNPRTGESMTIPAHKAVKLSASSTLKKAVSD NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccaagtccgagctcatcaaggctattgccaagcaggcgtctctcactgaggcgcag accaatgaggccgtcaaggctctcaccgacgtgatcaccgacgctctggccaagggcgac aagatccagcttcccggcctgctcaccgccgagaccgtcgagcgcccggcccgtaacggc cgcaatcctcgtaccggtgagtccatgacgattcccgcccacaaggcggtgaagctgtcg gcctccagcacgctgaagaaggccgtctccgactga

DBGET integrated database retrieval system