Acidovorax carolinensis NA3: CBP34_01045 Help Entry CBP34_01045       CDS       T04997                                  Name (GenBank) hypothetical protein   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism acin  Acidovorax carolinensis NA3 Pathway acin00361   Chlorocyclohexane and chlorobenzene degradation acin00362   Benzoate degradation acin00623   Toluene degradation acin01100   Metabolic pathways acin01120   Microbial metabolism in diverse environments acin01220   Degradation of aromatic compounds Module acin_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:acin00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CBP34_01045    00361 Chlorocyclohexane and chlorobenzene degradation     CBP34_01045    00623 Toluene degradation     CBP34_01045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  ART50525 UniProt:  A0A240TY49 LinkDB All DBs Position 1:224518..224751 Genome browser AA seq 77 aa AA seqDB search MNPPPLADNSLQCDVSRKFVRVLKRRDNGFIEFEFSIGWPELAVELMLPQAAFEAFCQAH RVQPVSNPIDDRATTIL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaacccaccgccactggccgacaacagcctgcaatgcgacgtgtcgcgcaagttcgtc cgtgtgctgaaaagacgggacaacggttttatcgagttcgagttttcgatcggctggcct gaactggccgtggagctgatgctgccgcaggccgccttcgaggcgttctgccaagcgcac cgggtgcagcccgtcagcaatccgatcgacgaccgcgctaccaccatcctttga

DBGET integrated database retrieval system