Acidovorax carolinensis NA3: CBP34_01135 Help Entry CBP34_01135       CDS       T04997                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism acin  Acidovorax carolinensis NA3 Pathway acin00362   Benzoate degradation acin00621   Dioxin degradation acin00622   Xylene degradation acin01100   Metabolic pathways acin01120   Microbial metabolism in diverse environments acin01220   Degradation of aromatic compounds Module acin_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:acin00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CBP34_01135    00622 Xylene degradation     CBP34_01135    00621 Dioxin degradation     CBP34_01135 Enzymes [BR:acin01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CBP34_01135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 CHMI Motif Other DBs NCBI-ProteinID:  ART50539 UniProt:  A0A240TY36 LinkDB All DBs Position 1:239967..240158 Genome browser AA seq 63 aa AA seqDB search MPFAQIYMIEGRTEEQKKAVIEKVTQALHEAVGAPKENVRVWIHDVPKENWGIAGVSAKE LGR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgccatttgcccagatttacatgatcgaaggccgcaccgaagagcagaagaaggccgtg attgaaaaggtaacgcaggcgctgcacgaggccgtgggtgcgcccaaggagaacgtgcgc gtgtggatccacgacgtgcccaaggagaactggggtattgccggcgtcagcgccaaggag ctggggcgctga

DBGET integrated database retrieval system