KEGG   Acidovorax carolinensis NA3: CBP34_12150
Entry
CBP34_12150       CDS       T04997                                 
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
acin  Acidovorax carolinensis NA3
Pathway
acin02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:acin00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CBP34_12150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acin02000]
    CBP34_12150
Enzymes [BR:acin01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     CBP34_12150
Transporters [BR:acin02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    CBP34_12150
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_22 RsgA_GTPase AAA_29 SMC_N AAA_16 NACHT MMR_HSR1 nSTAND1 AAA_28 T2SSE AAA_23
Other DBs
NCBI-ProteinID: ART52254
UniProt: A0A240U479
LinkDB
Position
1:complement(2601426..2602274)
AA seq 282 aa
MKTAIRESHLSLRGITVTYADGHTALAPTSLEVQHGGFLVLLGASGAGKSTLLRSINGLV
SPTDGEVSVADLPGGTVSKRNLLEHRRHCGMVFQQHHLIGRQSVLANVLMGKLATRGSLA
SLWPWSKADKLEALAAIDRVGLLEKALARADTLSGGQQQRIGIARALVQKPRLLLADEPV
ASLDPATAQSVLTLLHDICKKDRLTAIVSLHQVNLARMFADRIVGLRQGQVVFDGTAAQL
TEEAQSALYAKSSPVEPSRSSSPANMGSQFDSPSQSKEFLPC
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaaaactgcaattcgcgagagccatctgagcttgcggggtatcacggtgacctatgcc
gatggtcacacagcgcttgcgcccacctcgctggaggtacagcatggcgggttccttgtg
ctgctgggcgcgtcgggcgcgggaaagtcaacgctgctgcgcagcatcaatggcttggtt
agccccacagacggagaggtgtcggtggccgatctgccgggcggcaccgtctcaaaacgc
aaccttcttgagcatcggcgccactgcggcatggtgttccagcagcaccacctgatcggg
cggcaaagcgtgctggccaatgtgttgatgggcaagctcgccacccgcggatctctggcg
tcgttgtggccttggagcaaggctgacaagctggaggcgctggcggccattgaccgcgta
ggcctgcttgagaaagccctagcacgggcagacaccttgtctggtgggcaacaacaacgc
attggcattgcgcgtgccttggtgcaaaagccccgcctgctgctggccgatgagccggtg
gccagcctcgacccggcgaccgcgcagagtgtgttgaccctgcttcacgacatctgcaag
aaagaccgactcacggccatcgtgagtctgcatcaagtcaacctcgcgcgcatgttcgcc
gaccgcattgtgggccttcgccagggccaggtggtgttcgacgggacagcagcgcagttg
acggaagaagcccagtctgccctgtacgcgaagtcgtcacctgtcgaaccgtcccgttct
tcctcacctgccaacatgggcagtcaatttgattccccctctcaatccaaggagttttta
ccgtgctga

DBGET integrated database retrieval system