Acidovorax carolinensis NA3: CBP34_14395 Help Entry CBP34_14395       CDS       T04997                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acin  Acidovorax carolinensis NA3 Pathway acin01100   Metabolic pathways acin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CBP34_14395    00074 Mycolic acid biosynthesis     CBP34_14395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CBP34_14395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  ART52613 UniProt:  A0A240UFI1 LinkDB All DBs Position 1:complement(3089895..3090134) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgcgtcaaaaaaatcattgccgaacaactcggcgttgaagag tcccaagtcaccaacgaaaaagcctttgtggccgacctcggcgctgattctctggatacc gtcgaactcgtgatggcactcgaagacgaattcggcatcgagattcctgacgaagacgca gagaagatcacgacggtgcaaaacgccatcgactacgccaacacccaccagaaagcctga

DBGET integrated database retrieval system