Acidovorax sp. 1608163: EAG14_04530 Help Entry EAG14_04530       CDS       T05680                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acio  Acidovorax sp. 1608163 Pathway acio01100   Metabolic pathways acio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acio00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EAG14_04530    00074 Mycolic acid biosynthesis     EAG14_04530   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EAG14_04530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AYM95494 LinkDB All DBs Position 1009658..1009918 Genome browser AA seq 86 aa AA seqDB search MPQLEQEIKEIIISSLALEDITPDDIDPVAPLFVEGLGLDSIDALELGLALQKRYGLSLS ADSEQTRQHFGSVRSLAAFVAAHRAQ NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgcctcaacttgagcaagagatcaaagagatcatcatttcgtccctggcgctggaagac atcaccccagacgacattgaccctgtggcacctctgtttgtggagggcctggggctggat tccatcgatgccctggagttgggtctggcattgcaaaagcgctacgggctgagcctgtcc gccgattcggagcagacacgccagcactttggcagcgtccgttccctggctgccttcgtg gcagcccatcgcgcgcagtag

DBGET integrated database retrieval system