Acidovorax carolinensis P4: CBP36_01135 Help Entry CBP36_01135       CDS       T04962                                  Name (GenBank) phenol hydroxylase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism acip  Acidovorax carolinensis P4 Pathway acip00361   Chlorocyclohexane and chlorobenzene degradation acip00362   Benzoate degradation acip00623   Toluene degradation acip01100   Metabolic pathways acip01120   Microbial metabolism in diverse environments acip01220   Degradation of aromatic compounds Module acip_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:acip00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CBP36_01135    00361 Chlorocyclohexane and chlorobenzene degradation     CBP36_01135    00623 Toluene degradation     CBP36_01135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  ART60654 UniProt:  A0A240TXP3 LinkDB All DBs Position 243193..243438 Genome browser AA seq 81 aa AA seqDB search MEPAMNPEPLATDNLHCDVSRKFVRVLQRRDNGLIEFEFSIGWPELAVELMLPQRAFEAF CQAHQVRRIGDPSEGPASTIV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggagcccgcaatgaacccagagccattggccacagacaacctgcactgcgatgtgtcg cgcaagttcgtccgtgtgctgcaaagacgggacaacggtttgatcgagttcgagttttcg atcggctggcccgagctggccgtggagctgatgctgccgcagcgcgccttcgaggcgttc tgtcaggcgcaccaggtacgccgcatcggtgacccgagtgaaggccccgcttccaccatc gtttga

DBGET integrated database retrieval system