Acidovorax carolinensis P4: CBP36_01225 Help Entry CBP36_01225       CDS       T04962                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism acip  Acidovorax carolinensis P4 Pathway acip00362   Benzoate degradation acip00621   Dioxin degradation acip00622   Xylene degradation acip01100   Metabolic pathways acip01120   Microbial metabolism in diverse environments acip01220   Degradation of aromatic compounds Module acip_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:acip00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CBP36_01225    00622 Xylene degradation     CBP36_01225    00621 Dioxin degradation     CBP36_01225 Enzymes [BR:acip01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CBP36_01225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 CHMI Motif Other DBs NCBI-ProteinID:  ART57663 UniProt:  A0A240TY36 LinkDB All DBs Position 258646..258837 Genome browser AA seq 63 aa AA seqDB search MPFAQIYMIEGRTEEQKKAVIEKVTQALHEAVGAPKENVRVWIHDVPKENWGIAGVSAKE LGR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgccatttgcccagatttacatgatcgaaggccgcaccgaagagcagaagaaagccgtg atcgaaaaggtcacgcaggcgctgcacgaggccgtgggcgcgcccaaggaaaacgtgcgc gtgtggatccatgacgtgcccaaggaaaactggggcattgccggcgtcagcgccaaggag ctggggcgctga

DBGET integrated database retrieval system