Acidovorax carolinensis P4: CBP36_05180 Help Entry CBP36_05180       CDS       T04962                                  Name (GenBank) histone   KO K03746   DNA-binding protein H-NS Organism acip  Acidovorax carolinensis P4 Brite KEGG Orthology (KO) [BR:acip00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:acip03036]     CBP36_05180    03400 DNA repair and recombination proteins [BR:acip03400]     CBP36_05180 Chromosome and associated proteins [BR:acip03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     CBP36_05180 DNA repair and recombination proteins [BR:acip03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       CBP36_05180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS APC_N_CC DUF7754 Motif Other DBs NCBI-ProteinID:  ART58334 UniProt:  A0A240UA12 LinkDB All DBs Position 1111885..1112172 Genome browser AA seq 95 aa AA seqDB search MSSYKELLKQREALEQKINEARRNELSEAVAQVRALVAEFGLTAQDVFPAGRARSASAGS KVAPKYRNPATGQTWTGRGKPPKWIQNESREKFAI NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtccagctacaaagaactcctgaagcagcgtgaagcccttgagcagaagatcaacgaa gcccggcgcaatgagctttccgaagcagttgcacaggttcgtgcgctggtcgcggagttt ggcctgaccgcccaggatgtatttcccgctggccgggcgcgcagtgccagcgctggctcg aaggtggcccccaaataccgcaaccccgccacgggacagacctggaccggccgcggtaaa ccaccaaagtggattcagaacgagagccgtgagaagttcgccatttaa

DBGET integrated database retrieval system