Acidovorax carolinensis P4: CBP36_21650 Help Entry CBP36_21650       CDS       T04962                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism acip  Acidovorax carolinensis P4 Brite KEGG Orthology (KO) [BR:acip00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acip03032]     CBP36_21650    03036 Chromosome and associated proteins [BR:acip03036]     CBP36_21650    03400 DNA repair and recombination proteins [BR:acip03400]     CBP36_21650 DNA replication proteins [BR:acip03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CBP36_21650 Chromosome and associated proteins [BR:acip03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CBP36_21650 DNA repair and recombination proteins [BR:acip03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CBP36_21650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  ART61569 UniProt:  A0A240UKM1 LinkDB All DBs Position pACP4.4:complement(21737..22012) Genome browser AA seq 91 aa AA seqDB search MNRQDLIDAIAEDTEASKAATTRFLDSLITIVQNEVAKGGAVKLTGFGTFEKAAVAARTG RNPKTGAPIKIPSTHKPKFTPGATFKDLVKD NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaccgacaagacctgatcgacgccattgctgaagacaccgaagcatccaaggcggcc accacgcgctttctcgatagcctcatcaccatcgtgcaaaacgaggtggccaagggcggc gcggtaaagctcaccggctttggcactttcgagaaagcagccgtcgcggcgcgcaccggg cgcaacccgaagaccggcgcgccgatcaagattccctcgacccacaagccgaagttcacg cctggggccacgttcaaggacttggtgaaggactga

DBGET integrated database retrieval system