Acidovorax sp. DW039: ACDW_45800 Help Entry ACDW_45800        CDS       T10243                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism aciq  Acidovorax sp. DW039 Brite KEGG Orthology (KO) [BR:aciq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aciq03032]     ACDW_45800    03036 Chromosome and associated proteins [BR:aciq03036]     ACDW_45800    03400 DNA repair and recombination proteins [BR:aciq03400]     ACDW_45800 DNA replication proteins [BR:aciq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ACDW_45800 Chromosome and associated proteins [BR:aciq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ACDW_45800 DNA repair and recombination proteins [BR:aciq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ACDW_45800 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding Motif Other DBs NCBI-ProteinID:  BEU98874 LinkDB All DBs Position pACDW039_1:complement(319291..319500) Genome browser AA seq 69 aa AA seqDB search MSQESQVDELAGFCTFMLAKRAARMDKNPSTGAALKLPASRVPKFVAGTKFKAVVDLKAA KRKADKAGK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt ttgagccaagaaagccaggtggatgaattggcgggcttctgtactttcatgttggccaag cgtgcagcgcgtatggacaagaacccatcgaccggcgctgcgctgaagctccctgcgagc agggtacctaagtttgtcgcaggtaccaagttcaaggccgtggtggatctcaaggctgcc aagcgtaaggcggacaaggctgggaagtaa

DBGET integrated database retrieval system