Acidovorax carolinensis P3: CBP35_01530 Help Entry CBP35_01530       CDS       T04998                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acis  Acidovorax carolinensis P3 Pathway acis01100   Metabolic pathways acis01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acis00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CBP35_01530    00074 Mycolic acid biosynthesis     CBP35_01530   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CBP35_01530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ART54030 UniProt:  A0A240UH06 LinkDB All DBs Position complement(343877..344137) Genome browser AA seq 86 aa AA seqDB search MNLTEQVLHVLDSALRLQGRTTDFTRETPLLGALPELDSMAVLALLTGLENHFGITFNDE DVNGSAFASVGSLSDLVEQALARQDP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacttgaccgaacaagtccttcacgtgctcgacagcgcactcaggttgcaaggtcgc accacggatttcacgcgcgagaccccgctacttggcgccctgcccgaactcgactccatg gccgtgctggcactgctcactggtctggaaaaccacttcggcatcaccttcaatgacgaa gacgtcaatggctcggccttcgccagcgtgggcagcctgagcgacctggtggagcaggcg ctggcgcggcaagacccatga

DBGET integrated database retrieval system