Acidovorax carolinensis P3: CBP35_04560 Help Entry CBP35_04560       CDS       T04998                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acis  Acidovorax carolinensis P3 Pathway acis01100   Metabolic pathways acis01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acis00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CBP35_04560    00074 Mycolic acid biosynthesis     CBP35_04560   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CBP35_04560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  ART54494 LinkDB All DBs Position 978820..979059 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgcgtcaaaaaaatcattgccgaacaactcggcgttgaagag tcccaagtcaccaacgaaaaagcctttgtggccgacctcggcgctgattctctggatacc gtcgaactcgtgatggcactcgaagacgaattcggcatcgagattcctgacgaagacgca gagaagatcacgacggtgcaaaacgccatcgactacgccaacacccaccagaaagcctga

DBGET integrated database retrieval system