KEGG   Acidovorax carolinensis P3: CBP35_11865
Entry
CBP35_11865       CDS       T04998                                 
Name
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
acis  Acidovorax carolinensis P3
Pathway
acis00260  Glycine, serine and threonine metabolism
acis00261  Monobactam biosynthesis
acis00270  Cysteine and methionine metabolism
acis00300  Lysine biosynthesis
acis01100  Metabolic pathways
acis01110  Biosynthesis of secondary metabolites
acis01120  Microbial metabolism in diverse environments
acis01210  2-Oxocarboxylic acid metabolism
acis01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acis00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBP35_11865
   00270 Cysteine and methionine metabolism
    CBP35_11865
   00300 Lysine biosynthesis
    CBP35_11865
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    CBP35_11865
Enzymes [BR:acis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     CBP35_11865
SSDB
Motif
Pfam: AA_kinase ACT_9 ACT_7 ACT
Other DBs
NCBI-ProteinID: ART55512
UniProt: A0A240UCA1
LinkDB
Position
complement(2577621..2578889)
AA seq 422 aa
MALIVHKYGGTSMGSPERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELAPE
RAMQSYHRELDMLAATGEQASSALLAIALQSEGMQAVSYAGWQVPIRTDSSYTKARIESI
DDQRVRADLNAGKVVIVTGFQGIDSEGNITTLGRGGSDTSAVAVAAAMKAAECLIYTDVD
GVYTTDPRVVPEARRLQTVSFEEMLEMASLGSKVLQIRSVEFAGKYKVPMRVLSSFTPWD
IDINEEAKSGTLITFEEDEKMEQAVVSGIAFNRDEAKISVLGVPDKPGIAYQILGAVADA
NIEVDVIIQNVSKDGKTDFSFTVNRNDYARTVELLKEKVLPELGAQEVAGDTKICKVSIV
GIGMRSHVGVASKMFRTLSEEGINIQMISTSEIKTSVVIDEKYMELAVRSLHKAFELDQP
AA
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcattgatcgttcataaatacggcggcacctcgatgggctctcccgagcgcattcgc
aatgttgccaagcgcgtggccaaatgggcgcgggccggccaccagatggtggtggttccc
agcgccatgagcggcgaaaccaaccgcctgctcggcctggccaaggagctggcgcccgag
cgcgccatgcagtcttaccaccgcgagctggacatgctggccgccactggcgagcaggcc
tcgtcagcgttgctggccatcgcgctgcagtccgaaggcatgcaggcggtcagctacgcg
ggctggcaggttcccatccgcaccgacagcagctacaccaaggcgcgcatcgagtcgatt
gacgaccagcgtgtgcgtgccgacctgaacgccggcaaggtggtcatcgtcacgggcttt
cagggcatcgacagcgaaggcaacatcaccacgctgggtcgcggtggctccgacacatct
gccgtggccgtggcagccgccatgaaagccgccgaatgcctgatctacaccgatgtggat
ggcgtctacaccaccgacccacgcgtggtgcccgaggcacgtcgcctgcaaacggtgagc
ttcgaggaaatgctggaaatggccagcctcggcagcaaggtgctgcagatccgctcggtc
gagtttgcgggcaaatacaaggtgcccatgcgcgtgctctcgagcttcacgccctgggac
atcgatatcaacgaagaagccaagtccggcacgctgatcacttttgaggaagacgaaaaa
atggaacaagccgtcgtatccggcatcgctttcaaccgcgacgaagccaagatctcggtg
ctgggcgtgcccgacaagccaggcatcgcctaccagatcctgggcgcggtggctgacgcc
aacattgaagtcgacgtgatcatccagaacgtcagcaaggacggcaagaccgacttcagc
ttcaccgtgaatcgcaacgactatgcgcgtacggtcgagctgctaaaggaaaaagtgctg
cccgagctgggcgcgcaagaagtggcgggcgacaccaagatctgcaaggtgagcattgtc
ggtatcggcatgcgcagccatgttggcgtggccagcaagatgttccgcaccttgagcgaa
gagggcatcaacattcagatgatttccacttccgaaatcaagacctcggtggtcatcgac
gaaaaatacatggaactggctgttcgcagcctgcacaaggccttcgaactcgaccagcct
gccgcctga

DBGET integrated database retrieval system