Acidovorax carolinensis P3: CBP35_17725 Help Entry CBP35_17725       CDS       T04998                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism acis  Acidovorax carolinensis P3 Pathway acis00362   Benzoate degradation acis00621   Dioxin degradation acis00622   Xylene degradation acis01100   Metabolic pathways acis01120   Microbial metabolism in diverse environments acis01220   Degradation of aromatic compounds Module acis_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:acis00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CBP35_17725    00622 Xylene degradation     CBP35_17725    00621 Dioxin degradation     CBP35_17725 Enzymes [BR:acis01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CBP35_17725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 CHMI Motif Other DBs NCBI-ProteinID:  ART56382 UniProt:  A0A240TY36 LinkDB All DBs Position complement(3820455..3820646) Genome browser AA seq 63 aa AA seqDB search MPFAQIYMIEGRTEEQKKAVIEKVTQALHEAVGAPKENVRVWIHDVPKENWGIAGVSAKE LGR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgccatttgcccagatttacatgatcgaaggccgcaccgaagagcagaagaaagccgtg atcgaaaaggtcacgcaggcgctgcacgaggccgtgggcgcgcccaaggaaaacgtgcgc gtgtggatccatgacgtgcccaaggaaaactggggcattgccggcgtcagcgccaaggag ctggggcgctga

DBGET integrated database retrieval system