Acidovorax carolinensis P3: CBP35_17815 Help Entry CBP35_17815       CDS       T04998                                  Name (GenBank) phenol hydroxylase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism acis  Acidovorax carolinensis P3 Pathway acis00361   Chlorocyclohexane and chlorobenzene degradation acis00362   Benzoate degradation acis00623   Toluene degradation acis01100   Metabolic pathways acis01120   Microbial metabolism in diverse environments acis01220   Degradation of aromatic compounds Module acis_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:acis00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CBP35_17815    00361 Chlorocyclohexane and chlorobenzene degradation     CBP35_17815    00623 Toluene degradation     CBP35_17815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  ART56975 UniProt:  A0A240TXP3 LinkDB All DBs Position complement(3835854..3836099) Genome browser AA seq 81 aa AA seqDB search MEPAMNPEPLATDNLHCDVSRKFVRVLQRRDNGLIEFEFSIGWPELAVELMLPQRAFEAF CQAHQVRRIGDPSEGPASTIV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggagcccgcaatgaacccagagccattggccacagacaacctgcactgcgatgtgtcg cgcaagttcgtccgtgtgctgcaaagacgggacaacggtttgatcgagttcgagttttcg atcggctggcccgagctggccgtggagctgatgctgccgcagcgcgccttcgaggcgttc tgtcaggcgcaccaggtacgccgcatcggtgacccgagtgaaggccccgcttccaccatc gtttga

DBGET integrated database retrieval system