KEGG   Acidovorax carolinensis P3: CBP35_18645
Entry
CBP35_18645       CDS       T04998                                 
Name
(GenBank) phosphonate ABC transporter
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
acis  Acidovorax carolinensis P3
Pathway
acis02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:acis00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CBP35_18645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acis02000]
    CBP35_18645
Enzymes [BR:acis01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     CBP35_18645
Transporters [BR:acis02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    CBP35_18645
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_25 NACHT AAA_22 AAA_30 AAA_29 AAA_28 AAA_33 RsgA_GTPase DO-GTPase2 Mg_chelatase AAA_16 DEAD nSTAND1 AAA_18 nSTAND3 OCD_Mu_crystall AAA_24 TsaE IstB_IS21 AAA_23 MMR_HSR1
Other DBs
NCBI-ProteinID: ART56525
UniProt: A0A240U8Y0
LinkDB
Position
4012994..4013824
AA seq 276 aa
MKVQLDSATVRHPAARAGAPAALRGLSLAVAQGEQVAVIGPSGAGKTTLLQLLACAQRPA
IGRLQLDGRDPWALPRGALQRLRGRLFLAPQVPPLPPRQRVVTAVLAGRLPHESLWASVR
SLVYPTGIALAEQALSRFDVADKLFDRVDHLSGGERQRVGLARALASQASLLLVDEPLSA
LDPARAQQALASLTQAAHERGATLVATLHHVDMALQHFPRVIGLRDGALAFDLPAAQVTP
EHLHQLYAQHLDELAQTAPPAQDVPVAAAPVPMQCR
NT seq 831 nt   +upstreamnt  +downstreamnt
atgaaagtgcagctggacagcgccaccgtgcgccacccggccgcgcgcgctggtgcaccg
gcagcattgcgcggcctgagcctcgcggtagcgcagggcgagcaggtggccgtgatcggg
ccgtcgggcgcgggcaagaccacgctgctgcagctgctggcctgcgctcagcggcccgcc
attggccgcctgcaactggatggccgcgacccttgggcgctgccccgcggcgcattgcag
cgcctgcgcggtcgcctgtttctggccccccaggtgccgccactgccgccccggcagcgc
gtcgtcacggcggtgctggcagggcgcctgccgcacgaaagcctgtgggccagcgtgcgc
agcctggtctatcccaccggcatcgcgctggccgagcaggcgctgagccgttttgacgtg
gccgacaagctgttcgaccgggtagaccacctctcgggcggtgagcgccagcgggtgggc
ctggcccgggcgctggcctcgcaggccagcctgttgctggtggacgagccgctgtccgcg
ctcgacccggcgcgtgcgcagcaggccctggcctcgctcacacaggcggcccacgagcgc
ggcgccacgctggtcgccacgctgcaccatgtcgatatggccctgcagcatttcccgcgc
gtgatcgggctgcgcgatggcgcgctggccttcgacctgcctgcggcgcaggtcacgccc
gagcacctgcaccagctgtatgcgcagcatctggacgagctggcccaaacggcgccgccc
gcccaagatgtgcccgtggctgcggcacccgtgcccatgcagtgccgttag

DBGET integrated database retrieval system