Arthrobacter citreus: HPK19_25495 Help Entry HPK19_25495       CDS       T06606                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism acit  Arthrobacter citreus Brite KEGG Orthology (KO) [BR:acit00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acit03032]     HPK19_25495    03036 Chromosome and associated proteins [BR:acit03036]     HPK19_25495    03400 DNA repair and recombination proteins [BR:acit03400]     HPK19_25495 DNA replication proteins [BR:acit03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HPK19_25495 Chromosome and associated proteins [BR:acit03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HPK19_25495 DNA repair and recombination proteins [BR:acit03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HPK19_25495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 HU-CCDC81_euk_1 HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  QKE76152 LinkDB All DBs Position unnamed1:215838..216116 Genome browser AA seq 92 aa AA seqDB search MNKTELINAVAKASELSKKDAGKAVDAVFETISNALSNGNKVQLIGFGNFEVRERAARKG RNPQTGEEIEIAASKIPAFSAGKALKDAVKNS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacagaattgattaacgcagtagcaaaagcaagcgaattatcaaaaaaagat gcaggtaaggctgttgacgctgtatttgaaacgatttcgaatgctttatcaaatggcaat aaagtacaattgattggctttggtaatttcgaagttcgagaaagagccgcaagaaaagga agaaacccacaaacgggtgaggaaattgaaattgctgcttcaaaaatccctgcattttca gcaggaaaagctttaaaagatgccgttaaaaattcttaa

DBGET integrated database retrieval system