Acidovorax sp. JMULE5: EXV95_13320
Help
Entry
EXV95_13320 CDS
T10357
Name
(GenBank) PLP-dependent aminotransferase family protein
KO
K05825
2-aminoadipate transaminase [EC:2.6.1.-]
Organism
aciv Acidovorax sp. JMULE5
Pathway
aciv00300
Lysine biosynthesis
aciv00630
Glyoxylate and dicarboxylate metabolism
aciv01100
Metabolic pathways
aciv01110
Biosynthesis of secondary metabolites
aciv01210
2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:
aciv00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
EXV95_13320
09105 Amino acid metabolism
00300 Lysine biosynthesis
EXV95_13320
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Asp_aminotransf
Motif
Other DBs
NCBI-ProteinID:
QLA83789
LinkDB
All DBs
Position
2939540..2940682
Genome browser
AA seq
380 aa
AA seq
DB search
MNPSVIREILKVTEKPGIISLAGGLPSPKTFPVSAFAEASAAVLANDGPAALQYAASEGY
APLRQAIADFLPWDVDADQVLITTGSQQALDLIAKVLIDTDSRVLVETPTYLGALQAFTP
MEPAVVSVASDDEGVLIDDLKAKVGTGANKARFLYVLPNFQNPTGRTMSEARRAALVQAA
AELNLPLVEDNPYGDLWFDNPPPAPLTARNPEGCIYMGSFSKVLAPGLRLGFVVAPKAVY
PKLLQAKQAADLHTPGYNQRLVAEVMKGNFLDRHVPTIRALYKQQCEAMLAALDKEMQGL
GVQWNRPDGGMFLWVRLPEGMSAVELLPKAVERNVAFVPGAAFYADNADPRTLRLSFVTS
TVEQIATGIAALAAAIRDNK
NT seq
1143 nt
NT seq
+upstream
nt +downstream
nt
atgaacccttcggtcatccgcgaaatcctcaaggtcacggaaaagcccggcatcatcagc
ctggcgggcggcctgccctcgcccaagactttcccggtgtcggccttcgccgaagcctcg
gccgccgtgctggccaatgacggccccgctgccctgcaatacgccgccagcgaagggtat
gccccgctgcgccaggccatcgcggacttcctgccctgggatgtggatgccgaccaggtg
ctcatcaccaccggctcgcagcaggcgctggacctgatcgccaaggtgctgatcgacacc
gacagccgcgtgctggtggaaacacccacctacctgggcgcgctgcaggccttcacgccc
atggagcctgccgtggtgtccgtggccagcgatgacgaaggtgtgctcatcgacgacctg
aaggccaaggtgggcacaggtgccaacaaggcgcgctttttgtacgtgctgcccaacttc
cagaaccccacgggccgcaccatgagcgaagcccgccgcgccgccctggtgcaggctgcc
gctgaactgaacctgccgctggtagaagacaacccctacggcgacctgtggtttgacaac
ccgccacccgcgccgctgacggcccgcaaccctgaaggctgcatctacatgggctcgttc
tccaaggtgctggcacccggcctgcgcctgggttttgtggtggcgcccaaggcggtttac
cccaagctgctgcaggccaagcaggccgccgacctgcacacgcccggctacaaccagcgc
ctggtggccgaggtgatgaagggcaacttcctggaccgccatgtgcccaccatccgcgcg
ctgtacaagcagcagtgcgaggccatgctggccgcgctcgacaaggaaatgcagggcctc
ggtgtgcagtggaaccgccccgatggcggcatgttcctgtgggtgcgcttgcccgaaggc
atgagtgccgtcgaactgctgcccaaggcggtggagcgcaacgtggccttcgtgcccggc
gcggcgttttatgccgacaacgccgacccgcgcacactgcgcctgtcgttcgtcacatcg
acggtagagcagattgccaccggcattgctgcgctggcagcggccatccgcgataacaag
tga
DBGET
integrated database retrieval system