Acidithiobacillus sp. YTS05: MQE22_09345 Help Entry MQE22_09345       CDS       T08616                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aciy  Acidithiobacillus sp. YTS05 Pathway aciy01100   Metabolic pathways aciy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aciy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MQE22_09345 (acpP)    00074 Mycolic acid biosynthesis     MQE22_09345 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MQE22_09345 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF6137 HLH Motif Other DBs NCBI-ProteinID:  UTV80224 LinkDB All DBs Position complement(1892602..1892850) Genome browser AA seq 82 aa AA seqDB search MDDIAARVKKVVVEQLGVNEDEVTNEASFADDLGADSLDNVELVMALEEEFDCEIPDEEA EKISTVQQAIDYVSAHLPKQDA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggatgatatcgcagcacgtgtaaagaaagtggtcgtcgagcaactgggtgtgaatgaa gatgaggtcaccaacgaagcgtccttcgctgacgatctgggtgccgattccctcgacaac gtcgagttggtgatggccctcgaggaagaattcgactgcgaaattcccgacgaagaggcc gaaaagatttctacggtgcagcaggccatcgactacgtcagcgcgcatctgcccaagcag gatgcctga

DBGET integrated database retrieval system