KEGG   Acidovorax sp. KKS102: C380_15930
Entry
C380_15930        CDS       T02290                                 

Gene name
bphA2
Definition
(GenBank) biphenyl dioxygenase beta subunit BphA2
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00621  Dioxin degradation
ack01100  Metabolic pathways
ack01120  Microbial metabolism in diverse environments
ack01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    C380_15930 (bphA2)
Enzymes [BR:ack01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     C380_15930 (bphA2)
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: AFU46881
UniProt: E7FJB3
LinkDB
Position
3469756..3470337
AA seq 193 aa
MTAVAMAQKTAELIQEFAWPAQPVSPQLQHEVEQFYYREAQLLDHHNYNAWFDLLEQDIH
YWMPIRTTRIKRENDKEYIPAGANAHFDENHETMRGRIRQRTSELNWAEDPLSRTRHIVS
NVIVRETDTPATLEVASAFLVYRNRLERQVDIFAGERRDVLRRANNGLGFKIARRTILID
QSTILANNLSVFF
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaccgctgtcgccatggcccagaaaacggccgaattgatccaggaatttgcctggccc
gcccagcccgtgagcccgcaactgcaacacgaagtcgagcagttttattaccgcgaagcc
cagttgctggaccaccacaactacaacgcctggttcgacctactcgaacaggacatccac
tactggatgcccatccgcaccacgcgcatcaagcgtgaaaacgacaaggaatacatccca
gcgggcgccaacgcccacttcgacgaaaaccatgaaaccatgcgtggccgcatccgccag
cgcacttccgaactgaactgggccgaagacccgctgtcgcgcacgcggcatatcgtctcg
aacgtgatcgtgcgcgagaccgacacacccgccacactcgaagtggcctcggcctttttg
gtctatcgcaaccgcctcgagcggcaagtggacatttttgccggcgaacgccgtgacgtg
ctgcgccgcgccaacaatggcctgggcttcaaaattgcacgccgcaccatcctgatcgac
cagagcacgattctggccaacaacctcagcgtgtttttctaa

DBGET integrated database retrieval system