KEGG   Acidovorax sp. KKS102: C380_15945
Entry
C380_15945        CDS       T02290                                 

Gene name
bphC
Definition
(GenBank) 2,3-dihydroxybiphenyl dioxygenase BphC
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00361  Chlorocyclohexane and chlorobenzene degradation
ack00621  Dioxin degradation
ack01100  Metabolic pathways
ack01120  Microbial metabolism in diverse environments
ack01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    C380_15945 (bphC)
   00621 Dioxin degradation
    C380_15945 (bphC)
Enzymes [BR:ack01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.39  biphenyl-2,3-diol 1,2-dioxygenase
     C380_15945 (bphC)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4
Other DBs
NCBI-ProteinID: AFU46884
UniProt: E7FJB6
LinkDB
Position
3471548..3472429
AA seq 293 aa
MSIERLGYLGFAVKDVPAWDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDL
AYAGLEVDDAAALERMADKLRQAGVAFTRGDEALMQQRKVMGLLCLQDPFGLPLEIYYGP
AEIFHEPFLPSAPVSGFVTGDQGIGHFVRCVPDTAKAMAFYTEVLGFVLSDIIDIQMGPE
TSVPAHFLHCNGRHHTIALAAFPIPKRIHHFMLQANTIDDVGYAFDRLDAAGRITSLLGR
HTNDQTLSFYADTPSPMIEVEFGWGPRTVDSSWTVARHSRTAMWGHKSVRGQR
NT seq 882 nt   +upstreamnt  +downstreamnt
atgagtatcgaacgtttgggctacctcggcttcgccgtcaaggatgtacccgcctgggac
cactttctgaccaagagcgtgggtttgatggctgcgggttcggctggcgacgctgcgctg
taccgggccgatcagcgtgcctggcgcatcgccgtgcagccgggcgaactcgacgacctg
gcctacgcaggcttggaagtggatgacgccgccgcgctcgagcgcatggccgacaagctg
cgccaggcaggggtggccttcacccgcggtgacgaagcgctcatgcagcagcgcaaggtc
atgggcctgctgtgtctgcaagatccgttcggcctgccgctcgagatttactacggcccg
gcagaaatctttcatgagcccttcctgcctagcgcccccgtgtcgggcttcgtcacgggc
gaccagggcatcgggcacttcgtgcgctgcgtgcccgacacggcgaaggcgatggctttc
tacaccgaggtgcttggctttgtgctgtcggacatcattgacatccagatggggccggaa
acgagcgtgcccgcgcactttctgcactgcaatggccgtcaccacacgatcgccctggct
gctttcccgatcccgaagcgcatccaccacttcatgctgcaagccaacaccatcgacgat
gtgggctacgccttcgatcggctggacgccgccgggcgcatcacctccctgctcgggcgc
cacaccaacgaccagacgctctccttctatgccgacacgccgtcgcccatgatcgaggtc
gagttcggctgggggccgcgcacagtggattcctcctggacggtggcgcgacacagccgc
acggccatgtggggtcacaagtcggtacgcggccagcgctga

DBGET integrated database retrieval system