Arcobacter cloacae: ACLO_2356 Help Entry ACLO_2356         CDS       T06845                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aclo  Arcobacter cloacae Pathway aclo01100   Metabolic pathways aclo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aclo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACLO_2356 (acpP)    00074 Mycolic acid biosynthesis     ACLO_2356 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACLO_2356 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QKF90801 LinkDB All DBs Position 2329851..2330081 Genome browser AA seq 76 aa AA seqDB search MALLDDVKAVVVEQLDCDPAEVKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEDAE KILTVADAIKYIENNA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtaaaagcagtagttgtagagcaattagattgtgatccagca gaagtaaaagaagattcaaagttcattgaagatttaggtgctgactcattagatgtagta gaattagttatggctttagaagaaaaattcgatatcgaaatcccagatgaagatgcagaa aaaatcttaactgttgcagatgctataaaatacatcgaaaataacgcgtaa

DBGET integrated database retrieval system