KEGG   Granulicella tundricola: AciX9_0986
Entry
AciX9_0986        CDS       T01411                                 
Name
(GenBank) luciferase family oxidoreductase, group 1
Organism
acm  Granulicella tundricola
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-ProteinID: ADW68053
UniProt: E8X2C1
LinkDB
Position
complement(1165482..1166516)
AA seq 344 aa
MSLLRLSVLDQSPVPSGSTPAQALRNSISLAQHVESLGFNRFWMSEHHSMETLACTAPEI
MLARIGAETTKIRLGSGGIMLPHYTALKVAETFRTLHALYPNRIDLGIGRAPGGGPLEAA
ALRRNRNVPQVDDFLDQLSELIAFLHQEFPPQHPFSKIMVTPEMPGGPDVWLLGSSMWSS
ETAAHFGLPYAFAHFFSPDPTRRAIENYQADFQPNLSLGVQARTSPEAMAAVGVICAETQ
AEADRLALSVRLLQLRIRMNDRRPVASPEEAAAELPQHGPAAPETGEFPRYVVGTPDVVK
EQLTAMADALKIKELVVNTIVHDHAARLRSYTLLAEAFAATKAA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagcttgcttcgactttccgttctcgatcagagtcctgtgccatccggttccacgccg
gcgcaggcgctgcgtaactcgatctcgctggcacagcatgtggagtcgctgggattcaac
cggttctggatgtcggagcatcattcgatggagacgctggcttgtacggcgccggagatc
atgctcgcgagaattggggcggagacgacgaagatccggctggggtcgggtgggatcatg
ctgccgcactacacggcactgaaggtggcagagacgttccggacgctgcatgcgctttat
ccgaaccggatcgacctggggattgggcgggctccggggggtgggccgctggaggctgcg
gctttgcggcgcaaccggaacgtgccgcaagtggatgactttctggatcagctctcggag
ctgattgcgtttctgcaccaggagtttccgccgcagcatccgttttcaaagatcatggtg
acgccggagatgccgggtggaccggatgtgtggctgctggggtcgagcatgtggagctct
gagacggcagcgcactttgggctgccgtatgccttcgcccacttcttctcgccggacccg
acgcggcgtgcgatcgagaactatcaggcggactttcagccgaatttgtcgctgggggtg
caggctcggacgagcccggaggcgatggctgccgtgggggtgatctgcgcggagacgcag
gcggaggcagatcggctggccctgagcgtgcggctgctgcagttgagaattcggatgaac
gaccggcggccggtcgcgtcgcctgaggaggctgctgcggagctgccacaacatgggcct
gcggcccctgagacgggggagtttccacggtatgtggtggggactccggatgtggtgaag
gagcagcttacggcgatggcggatgcgctgaagatcaaggagctggtcgtgaacacgatc
gttcacgaccatgccgcgcggctccgcagctataccttgctggcggaggcttttgcggcg
accaaggctgcctga

DBGET integrated database retrieval system