Anaplasma centrale: ACIS_00958 Help Entry ACIS_00958        CDS       T01133                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism acn  Anaplasma centrale Pathway acn01100   Metabolic pathways acn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACIS_00958 (acpP)    00074 Mycolic acid biosynthesis     ACIS_00958 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACIS_00958 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  ACZ49457 UniProt:  D1ASK4 LinkDB All DBs Position 958790..959086 Genome browser AA seq 98 aa AA seqDB search MEGGEVGNLKSDDAVLEDIKSKVMETVVSCLKLKDEQKQVLSGTTNLAKDFNLDSLDFVD LIMSLEEKFSIEITDEEAQGLETVDDICKYIHGKSGSE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggaaggtggtgaggtagggaacttgaagtctgacgatgctgttttggaggacatcaaa tctaaggtcatggagaccgtggttagctgtctaaaattgaaggatgagcagaagcaagtt ctttctgggaccaccaatttagccaaggatttcaacctggatagcttggatttcgtagac ctgattatgtctttagaggagaagttttctatagagatcaccgacgaagaagcgcagggg ttggaaactgtggatgatatatgcaagtacatacatggtaagtccggttctgagtag

DBGET integrated database retrieval system