Alterisphingorhabdus coralli: RB602_03085 Help Entry RB602_03085       CDS       T10589                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acoa  Alterisphingorhabdus coralli Pathway acoa01100   Metabolic pathways acoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RB602_03085    00074 Mycolic acid biosynthesis     RB602_03085   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RB602_03085 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 DUF6924 Motif Other DBs NCBI-ProteinID:  WOE75711 UniProt:  A0AA97F8Y8 LinkDB All DBs Position complement(678742..678987) Genome browser AA seq 81 aa AA seqDB search MTDRSATWDKVTEQITPFNKKGIELTEATTFQHDLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIENVGQLVDAVMKLADS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccgatcgcagcgcgacatgggacaaagtgaccgaacagatcacccctttcaacaaa aagggcatagagctgaccgaagccacaaccttccagcatgatctggaatgggacagcctg acggtcatggattttgtcgccgcgattgaggatgagtttgacatcatcatcaccatgaac atgcaagccgagattgagaatgtcggccagctggtcgatgcggtgatgaagctggcggat agctga

DBGET integrated database retrieval system