Alterisphingorhabdus coralli: RB602_07615 Help Entry RB602_07615       CDS       T10589                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acoa  Alterisphingorhabdus coralli Pathway acoa01100   Metabolic pathways acoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RB602_07615    00074 Mycolic acid biosynthesis     RB602_07615   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RB602_07615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  WOE76570 UniProt:  A0AA97FCJ9 LinkDB All DBs Position 1605422..1605658 Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEADKVSTDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKISTVNDAIEYIDNNQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagctgatcgcgtaaagaaaattgttgtcgagcatctcggcgtagaagcg gacaaggtatcaaccgatgccagcttcattgatgatctgggcgcagacagcctcgacatt gtcgagctggtcatggcgtttgaagaagaattcggcgttgaaatccccgacgatgctgct gagaaaatcagcaccgtcaacgacgctatcgaatatatcgataataatcagggctga

DBGET integrated database retrieval system