Candidatus Andeanibacterium colombiense: P0Y56_00395 Help Entry P0Y56_00395       CDS       T09799                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acob  Candidatus Andeanibacterium colombiense Pathway acob01100   Metabolic pathways acob01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acob00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P0Y56_00395    00074 Mycolic acid biosynthesis     P0Y56_00395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P0Y56_00395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 DUF7080 DUF5783 Motif Other DBs NCBI-ProteinID:  WEK46784 UniProt:  A0AAJ5X6A9 LinkDB All DBs Position 74429..74665 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVEADKVTPDASFIDDLGADSLDIVELVMAFEEEFCVEIPDDAA EKIATVGDANKYIEDHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgccgaacgcgtgaagaagatcgttgtcgaacaccttggtgtcgaagcc gacaaagtcacgcccgatgccagcttcatcgacgatctgggtgcagacagcctcgacatc gtcgagctggtgatggcgttcgaagaagaattctgcgtcgagatccccgacgacgcagcc gagaagatcgccaccgttggcgatgcgaacaagtacatcgaagatcacaagggctga

DBGET integrated database retrieval system