Atta colombica: 108692477 Help Entry 108692477         CDS       T11098                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism acoc  Atta colombica Pathway acoc04013   MAPK signaling pathway - fly acoc04145   Phagosome acoc04148   Efferocytosis acoc04310   Wnt signaling pathway acoc04517   IgSF CAM signaling acoc04518   Integrin signaling acoc04620   Toll-like receptor signaling pathway acoc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:acoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     108692477    04310 Wnt signaling pathway     108692477   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     108692477    04518 Integrin signaling     108692477  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108692477    04148 Efferocytosis     108692477  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108692477  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108692477  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acoc04131]     108692477   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acoc04147]     108692477    04031 GTP-binding proteins [BR:acoc04031]     108692477 Membrane trafficking [BR:acoc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108692477  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     108692477   Macropinocytosis    Ras GTPases     108692477  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     108692477 Exosome [BR:acoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108692477   Exosomal proteins of other body fluids (saliva and urine)    108692477   Exosomal proteins of colorectal cancer cells    108692477   Exosomal proteins of bladder cancer cells    108692477 GTP-binding proteins [BR:acoc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108692477 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  108692477 NCBI-ProteinID:  XP_018056231 UniProt:  A0A151HYZ1 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagccatcaagtgcgtggtcgtcggcgacggtgcggtaggtaaaacatgcttattg ataagctacaccaccaatgcatttcctggggaatatattccaacggtattcgacaactat tctgcgaatgtgatggtcgatggaaagccaattaatcttggcttgtgggacacagcggga caagaggattatgacagactacggccgttgtcttatccacaaactgatgtctttctcatc tgcttttcattggtgaacccggcaagttttgaaaatgtgcgtgccaaatggtatccggaa gtacgtcatcactgtcctgctactccaattattctagttggcactaaactagatctgcgt gaggacaaggagactatcgaacgtttgaaagacaaaaaactagctcccattacttatcct cagggtttagcaatggcaaaggagatcggtgctgtaaaatatttggaatgctccgctttg acacaaaaaggcttgaagactgtgtttgacgaagcgatacgcgctgtactgtgcccggtt ctgcaagtgaagccaaagcgcagatgtttccttctataa

DBGET integrated database retrieval system