Aphelocoma coerulescens (scrub jay): 138101651 Help Entry 138101651         CDS       T10543                                  Name (RefSeq) claudin-7-like   KO K06087   claudin Organism acoe  Aphelocoma coerulescens (scrub jay) Pathway acoe03272   Virion - Hepatitis viruses acoe04382   Cornified envelope formation acoe04514   Cell adhesion molecule (CAM) interaction acoe04530   Tight junction Brite KEGG Orthology (KO) [BR:acoe00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     138101651  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     138101651  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     138101651  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     138101651  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acoe03037]     138101651    04147 Exosome [BR:acoe04147]     138101651 Cilium and associated proteins [BR:acoe03037]  Other cilia and associated proteins   Stereociliary proteins    138101651 Exosome [BR:acoe04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    138101651   Exosomal proteins of colorectal cancer cells    138101651 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF7847 Motif Other DBs NCBI-GeneID:  138101651 NCBI-ProteinID:  XP_068855525 LinkDB All DBs Position Unknown AA seq 165 aa AA seqDB search MGDGRDTGGTGQLQCEAHKSILALPAHLQATRALLVVAGVLGPLALAAAVGGMKCTRCGG DDPRRKASVAAAGGALFILAGLLGLVACSWYGHRIVTNFYDASTPINAKYEFGSALFLGW AGAALALLGGSLLASSRCSCGGRGAAPARGYPRPKGPPSSSREYV NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgggggatggcagggacacggggggcaccgggcaactgcagtgcgaggcccacaagtcc atcctggcactgccagctcacctgcaggccacgcgggcgctcctggtggtcgcgggggtc ctgggcccgctggcgctggccgcggccgtggggggcatgaagtgcacgcgctgcgggggc gacgacccccggagaaaagcctcggtggccgccgcggggggggccctcttcatcctcgcg ggcctgctgggtctcgtcgcctgctcctggtacggccacaggatcgtcaccaacttctac gacgcctccacgcccatcaacgccaagtacgagttcggctcggcgctgttcctgggctgg gcgggggcggccctggcgctgctcggggggtccctcctggcctcgtcgcgctgctcctgc ggggggaggggcgcggccccagcccggggctacccccgccccaagggcccccccagcagc agccgcgagtacgtctga

DBGET integrated database retrieval system