Aphelocoma coerulescens (scrub jay): 138107527 Help Entry 138107527         CDS       T10543                                  Symbol MTLN Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism acoe  Aphelocoma coerulescens (scrub jay) Brite KEGG Orthology (KO) [BR:acoe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:acoe03029]     138107527 (MTLN) Mitochondrial biogenesis [BR:acoe03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     138107527 (MTLN) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom PerM Motif Other DBs NCBI-GeneID:  138107527 NCBI-ProteinID:  XP_068864911 LinkDB All DBs Position 3:2597373..2598174 Genome browser AA seq 58 aa AA seqDB search MVLEALRPRAVRWALLAAFAAGVVVGWQAGRARRRFLRWRQRYLQRRLAAAQEQLEAA NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atggtgctggaggcgctgcggccgcgggccgtgcgctgggcgctgctggccgccttcgct gccggagtggtggtgggctggcaggcgggccgggcgcgccgccgcttcctgcgctggcgg cagcgatacctccagcgccgcctcgccgccgcacaggagcagctggaagcggcctga

DBGET integrated database retrieval system