Aphelocoma coerulescens (scrub jay): 138109156 Help Entry 138109156         CDS       T10543                                  Name (RefSeq) C-C motif chemokine 5-like   KO K12499   C-C motif chemokine 5 Organism acoe  Aphelocoma coerulescens (scrub jay) Pathway acoe04060   Cytokine-cytokine receptor interaction acoe04620   Toll-like receptor signaling pathway acoe04621   NOD-like receptor signaling pathway acoe04623   Cytosolic DNA-sensing pathway acoe05164   Influenza A acoe05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:acoe00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138109156  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138109156    04621 NOD-like receptor signaling pathway     138109156    04623 Cytosolic DNA-sensing pathway     138109156  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     138109156    05168 Herpes simplex virus 1 infection     138109156  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acoe04052]     138109156    00536 Glycosaminoglycan binding proteins [BR:acoe00536]     138109156 Cytokines and neuropeptides [BR:acoe04052]  Cytokines   Chemokines    138109156 Glycosaminoglycan binding proteins [BR:acoe00536]  Heparan sulfate / Heparin   Chemokines    138109156 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 TTRAP Motif Other DBs NCBI-GeneID:  138109156 NCBI-ProteinID:  XP_068868330 LinkDB All DBs Position 4:69780832..69781795 Genome browser AA seq 102 aa AA seqDB search MRVLAVTLAVLLLVAICSLAEADLRISRRAAFSHMQETNLICCYHYTSRPLPRSMIHSAY KTSYSCSKPAVVLVTRKGKKVCVNPEARWVQEYLKHLEQPEY NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgagggtcctcgcagtcaccctggctgttctgctccttgtggccatctgctccctggct gaggctgatctcagaatctccaggcgtgctgcattttcccacatgcaagaaaccaacctc atctgctgctaccactacacttcacgcccccttccacgcagcatgatccactctgcctac aagaccagctacagctgctcaaagccagccgtggttctggtcactaggaaagggaagaag gtgtgcgtaaaccccgaggctcgctgggtgcaagaatacctgaagcacctggagcagcca gagtactga

DBGET integrated database retrieval system