Aphelocoma coerulescens (scrub jay): 138112110 Help Entry 138112110         CDS       T10543                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism acoe  Aphelocoma coerulescens (scrub jay) Pathway acoe03030   DNA replication acoe03410   Base excision repair acoe03420   Nucleotide excision repair acoe03430   Mismatch repair acoe03440   Homologous recombination Brite KEGG Orthology (KO) [BR:acoe00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     138112110 (POLD4)    03410 Base excision repair     138112110 (POLD4)    03420 Nucleotide excision repair     138112110 (POLD4)    03430 Mismatch repair     138112110 (POLD4)    03440 Homologous recombination     138112110 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acoe03032]     138112110 (POLD4)    03400 DNA repair and recombination proteins [BR:acoe03400]     138112110 (POLD4) DNA replication proteins [BR:acoe03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     138112110 (POLD4) DNA repair and recombination proteins [BR:acoe03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       138112110 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      138112110 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  138112110 NCBI-ProteinID:  XP_068874895 LinkDB All DBs Position 5:2427942..2429166 Genome browser AA seq 132 aa AA seqDB search MSRRAMEQPRRITDSFPRRRRRGPGRPPGRLKDKKDKDKDKDKVQVKVKVKVQVRDCPRA PSQPPPDPALLEMLRRFDLSWEYGPCTGITRLQRWERAQELGLSPPGAIRDALLEHRDNP DVTYSLWHEYEL NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgtcgcgcagggccatggagcagccccggcgcatcaccgactccttcccgcggcggcgg cggcggggccccgggcggccccccggcaggctcaaggacaagaaggacaaggacaaggac aaggacaaggtgcaggtgaaggtgaaggtgaaggtgcaggtgcgggactgtccccgcgcc ccctcgcagccccccccggacccggcgctcctggagatgctgcggcgcttcgatctctcc tgggaatacggaccctgcaccgggatcacccgcctgcagcgctgggagcgggcacaagag ctggggctgagcccccccggcgccatccgtgacgccctcctggagcaccgggacaacccc gatgtcacctacagcctctggcacgagtacgagctctga

DBGET integrated database retrieval system