Aphelocoma coerulescens (scrub jay): 138112321
Help
Entry
138112321 CDS
T10543
Symbol
GHITM
Name
(RefSeq) growth hormone-inducible transmembrane protein
KO
K21890
growth hormone-inducible transmembrane protein
Organism
acoe Aphelocoma coerulescens (scrub jay)
Brite
KEGG Orthology (KO) [BR:
acoe00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
acoe02000
]
138112321 (GHITM)
Transporters [BR:
acoe02000
]
Other transporters
Pores ion channels [TC:
1
]
138112321 (GHITM)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Bax1-I
Motif
Other DBs
NCBI-GeneID:
138112321
NCBI-ProteinID:
XP_068875305
LinkDB
All DBs
Position
6:complement(10295195..10305452)
Genome browser
AA seq
346 aa
AA seq
DB search
MLAARLVCLRALPCQALRPTITQAPPALRSSSIKAYRLWQPSQSYATRVRTGARRGKLGQ
EVKEAAFEPSAETALKADRLGKFIVAGGAAVGLGALCYYGMGMSSEIGAIERAAIWPQYV
KDRIQSTYMYFAGSIGMTALSAAAVSRSPALMNLMTRGSWLAIGATFAAMIGAGMLVRSI
SYEDNPVAKHAAWMMHSGVLGAVVAPLAFLGGPLLIRAAWYTAGIVGGLSTVAMCAPSEK
FLNMGGPLGIGLGFVIASSVGSMFLPPTSAFGAGLYSVAVYGGLVLFSMFLLYDTQLVVK
RAETLPFYGVTKYDPINACMGIYTDTLNIFIRVATMLAGGGGGRKK
NT seq
1041 nt
NT seq
+upstream
nt +downstream
nt
atgctggctgccaggctggtgtgcctgagggcactgccatgccaggctctccgccccacc
attactcaggctcccccagccttgaggagctccagtataaaagcatacaggctgtggcag
cctagccagagttatgccaccagagtaagaacgggtgcaaggcgtggaaaactcggccag
gaagtgaaagaagcagcatttgagccatctgcagaaactgcacttaaagctgatcgcctg
gggaaattcattgttgctggaggggctgctgttggcttgggagccctctgctactatgga
atgggcatgtccagtgagattggagctattgaaagagctgctatttggccacagtatgtg
aaggacagaattcagtctacgtacatgtactttgcgggcagcattggcatgacagctctg
tctgctgcagcagtgagcagatctcctgcactcatgaacctcatgacaaggggctcctgg
ctggcaattggtgcaacttttgcagctatgattggtgctggaatgttggtcaggtccata
tcctatgaagataatccagtagctaaacatgcagcgtggatgatgcattcaggtgtcctg
ggtgcagtggtggctcctctggccttccttgggggtcctctgctgatcagagctgcctgg
tacactgctggaatcgttggggggctctcaactgtggccatgtgtgctccaagcgaaaaa
ttcctgaacatgggaggaccacttggcataggcttaggctttgttattgcctcttcagtc
ggatccatgttcttgcctcccacctctgcttttggcgccggcttgtattcggtagcagtc
tatggtggcctggtgctcttcagcatgttcctgctctatgatacacagctggtggtgaaa
cgggcagaaactctgcccttctacggagtgactaaatacgaccccatcaatgcatgcatg
ggtatctacaccgatacactgaacatcttcattcgtgtggccaccatgcttgcaggtggt
ggaggtggcaggaaaaagtaa
DBGET
integrated database retrieval system