Aphelocoma coerulescens (scrub jay): 138114442 Help Entry 138114442         CDS       T10543                                  Symbol CCL20 Name (RefSeq) C-C motif chemokine 20   KO K14625   C-C motif chemokine 20 Organism acoe  Aphelocoma coerulescens (scrub jay) Pathway acoe04060   Cytokine-cytokine receptor interaction Brite KEGG Orthology (KO) [BR:acoe00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138114442 (CCL20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acoe04052]     138114442 (CCL20) Cytokines and neuropeptides [BR:acoe04052]  Cytokines   Chemokines    138114442 (CCL20) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  138114442 NCBI-ProteinID:  XP_068879952 LinkDB All DBs Position 9:10953224..10963893 Genome browser AA seq 100 aa AA seqDB search MIGCSSKSMVLVSLLGLLVLLLCGTSEAQSNQDCCLSYTKVRLPRWALKGYTEQLSSEVC DIPAIIFHTSSGLKACVNPKEGWVKKHLLFLSHKLRKMSA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgattggctgcagcagcaagagcatggtcctggtttccctgctggggctcctggtgctg ctcctgtgcggcacctccgaagcacaaagcaaccaggattgttgcctgtcttacaccaaa gtgcgtctgcctcggtgggccctgaagggttacactgaacagctctccagtgaggtctgt gacatccctgccatcattttccacacctccagtgggctgaaggcctgtgtaaatcctaag gaaggctgggtcaagaaacatcttctttttctgagccacaagctcaggaagatgtcagcc tga

DBGET integrated database retrieval system