KEGG   Aphelocoma coerulescens (scrub jay): 138117336
Entry
138117336         CDS       T10543                                 
Name
(RefSeq) von Hippel-Lindau disease tumor suppressor-like
  KO
K03871  von Hippel-Lindau disease tumor supressor
Organism
acoe  Aphelocoma coerulescens (scrub jay)
Pathway
acoe04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:acoe00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    138117336
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:acoe04121]
    138117336
Ubiquitin system [BR:acoe04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   Cul2 complex
    Target recognizing subunit
     138117336
SSDB
Motif
Pfam: VHL VHL_C STAT2_C Arm_vescicular
Other DBs
NCBI-GeneID: 138117336
NCBI-ProteinID: XP_068883619
LinkDB
Position
12:21267003..21270170
AA seq 168 aa
MSPPGPGPGPGRPGGAEPVLRSVNTRELSEVVFNNHSPRYVLPVWLDFEGQPRCYPVLQP
RTGRVMRSYRGHLWLFRDAGTNDGLLVNQQELFVAAPNVTKADITLPVFTLKERCLQVVR
SLVSPMDYRKLDIVQSLYDELEDHPDIWKDLQRLSLERNEALRNKILE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtcgccgccagggccggggccggggccggggcgcccgggcggggccgagcctgtcctg
cgctctgtcaacacgcgggagctctctgaggtcgtcttcaacaaccacagcccccgctac
gtgctgcccgtctggctggacttcgagggccagccgcgctgctacccggtcctgcagccg
cgcaccgggcgcgtcatgcgcagctaccgggggcacctctggctgttccgggatgcaggg
accaacgatgggctgcttgtcaaccagcaggagctgttcgtggcagcccccaatgtgacc
aaagctgacatcacactgccagtgttcaccctgaaggagagatgtctgcaggttgtgcgc
agtctggtcagcccaatggactacaggaaactggacattgttcagtcgttatatgacgag
ctggaggatcatcctgatatttggaaggatcttcaacggctttctctggagaggaatgaa
gcactgaggaacaaaattctggaataa

DBGET integrated database retrieval system