Aphelocoma coerulescens (scrub jay): 138117795 Help Entry 138117795         CDS       T10543                                  Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism acoe  Aphelocoma coerulescens (scrub jay) Pathway acoe03082   ATP-dependent chromatin remodeling acoe04217   Necroptosis Brite KEGG Orthology (KO) [BR:acoe00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     138117795  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     138117795  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:acoe03036]     138117795   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acoe04147]     138117795 Chromosome and associated proteins [BR:acoe03036]  Eukaryotic type   Nucleosome assembly factors    Histones     138117795 Exosome [BR:acoe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138117795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  138117795 NCBI-ProteinID:  XP_068884457 LinkDB All DBs Position 12:9682061..9683672 Genome browser AA seq 126 aa AA seqDB search MSGRGKSGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLS AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TQSSKK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccgggggaagtccggcggaaaggcgcgggccaaggccaagtcgcgctcgtcg cgggccgggctgcagtttcccgtggggcgggtgcatcggctgctgcggaagggtaactac gcggagcgggtgggcgccggggcgccggtgtacctggcggccgtgctggagtacctgtcg gctgagatcctggagctggcgggcaacgcggctcgcgacaacaagaagacgcgcatcatc ccgcggcacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgaccatcgcccagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acgcagagctccaagaagtga

DBGET integrated database retrieval system