Aphelocoma coerulescens (scrub jay): 138120596 Help Entry 138120596         CDS       T10543                                  Name (RefSeq) C-C motif chemokine 4 homolog   KO K12964   C-C motif chemokine 4 Organism acoe  Aphelocoma coerulescens (scrub jay) Pathway acoe04060   Cytokine-cytokine receptor interaction acoe04620   Toll-like receptor signaling pathway acoe04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:acoe00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138120596  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138120596    04623 Cytosolic DNA-sensing pathway     138120596  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acoe04052]     138120596 Cytokines and neuropeptides [BR:acoe04052]  Cytokines   Chemokines    138120596 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  138120596 NCBI-ProteinID:  XP_068889487 LinkDB All DBs Position 19:282278..283982 Genome browser AA seq 90 aa AA seqDB search MKVSAAGLALLLISASFSQTFSGPAGSDLPICCVRYTQHRLPWKRIQRHYITSSSCPLTA IVFVTKEGRQVCANPENTWVQKHLQILEQN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcagctggattggctcttctcctcatttcagcctccttctcccagact ttctctggtccagctggatctgacctcccaatctgctgtgtcagatatacacagcacagg ctcccatggaagcgcatccagcgtcattatatcaccagcagcagttgtcccctgacggcc attgtgtttgtcacaaaggaaggccgccaggtctgtgccaatcccgaaaacacctgggtc caaaaacacctgcaaatcttggagcagaactga

DBGET integrated database retrieval system